DR749499

EST Overview
NameDR749499
Unique NameDR749499
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length267
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of DR749499 vs. TrEMBL
Match: B9R7Z9_RICCO (Glycosyltransferase, putative OS=Ricinus communis GN=RCOM_1595730 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 3.188e-7
Identity = 27/38 (71.05%), Postives = 32/38 (84.21%), Query Frame = 1
Query:   13 KRLTWERKGMRKCKEMFLEHHMSHRIALVLKDVLRKAK 126
            +RLT  + G ++ KE FLEHHMSHRIALVLK+VLRKAK
Sbjct:  439 RRLTMGKNGYKRVKERFLEHHMSHRIALVLKEVLRKAK 476          
BLAST of DR749499 vs. TAIR peptide
Match: AT1G19710.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr1:6814920-6816716 FORWARD LENGTH=479)

HSP 1 Score: 50.8322 bits (120), Expect = 1.987e-7
Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 1
Query:   16 RLTWERKGMRKCKEMFLEHHMSHRIALVLKDVLRKAK 126
            R T  +KG  + KEMFLEHHMSHRIA VL++VL+ AK
Sbjct:  433 RNTMGKKGYERVKEMFLEHHMSHRIASVLREVLQHAK 469          
BLAST of DR749499 vs. TAIR peptide
Match: AT1G75420.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr1:28305469-28307317 FORWARD LENGTH=463)

HSP 1 Score: 50.447 bits (119), Expect = 2.595e-7
Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 1
Query:   16 RLTWERKGMRKCKEMFLEHHMSHRIALVLKDVLRKAK 126
            RL   + G  + KEMFLEHHMSHRIA VLK+VL+ AK
Sbjct:  422 RLRMGKNGYERVKEMFLEHHMSHRIASVLKEVLQHAK 458          
The following BLAST results are available for this feature:
BLAST of DR749499 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 1
Match NameE-valueIdentityDescription
B9R7Z9_RICCO3.188e-771.05Glycosyltransferase, putative OS=Ricinus communis ... [more]
back to top
BLAST of DR749499 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT1G19710.11.987e-764.86| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
AT1G75420.12.595e-764.86| Symbols: | UDP-Glycosyltransferase superfamily ... [more]
back to top
Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>DR749499 ID=DR749499|Name=DR749499|organism=Cicer arietinum|type=EST|length=267bp
GAGGCCCGTTATAAGAGACTCACATGGGAAAGAAAGGGCATGAGAAAGTG
CAAAGAGATGTTTTTGGAGCACCATATGTCGCATAGAATTGCATTAGTTC
TCAAAGACGTTTTACGGAAGGCAAAGCACACTTACATTAACCAGCTTAGG
TACTTCACTATTACAATTGTAAATTGCTTCNAAAGAAAAAGGGAGAATGC
TTCAGTGAGAATTAATGAATCGTATATCCCACTTCCTTTGTTCTGTATGG
TATGCGTAACGGGCCTC
back to top