rna-KK1_020580
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP7_ARATH (Cyclin-dependent kinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=KRP7 PE=1 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 4.974e-17 Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = 1 Query: 295 TPPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRL 429 +P AE+++FF+ AE+YEQKRF EKYN+DIV D PLEGRYQWV L Sbjct: 149 SPTQAELDDFFSAAERYEQKRFTEKYNYDIVNDTPLEGRYQWVSL 193
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP3_ARATH (Cyclin-dependent kinase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=KRP3 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.296e-13 Identity = 27/44 (61.36%), Postives = 37/44 (84.09%), Query Frame = 1 Query: 298 PPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRL 429 P ++E+EEFFA AE+ +Q+ F EKYNFDIV D+PL GRY+WV++ Sbjct: 177 PTTSEMEEFFAYAEQQQQRLFMEKYNFDIVNDIPLSGRYEWVQV 220
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP6_ORYSJ (Cyclin-dependent kinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=KRP6 PE=3 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 1.477e-13 Identity = 26/50 (52.00%), Postives = 36/50 (72.00%), Query Frame = 1 Query: 283 RKVETPPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 432 +K +PP E+E F A AE +RFA KYN+DIV+D P++GRY+WVR+ Sbjct: 36 KKGRSPPEEEVEAFLAAAESSVARRFAAKYNYDIVKDAPMDGRYEWVRVR 85
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP6_ARATH (Cyclin-dependent kinase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=KRP6 PE=1 SV=2) HSP 1 Score: 63.929 bits (154), Expect = 5.032e-12 Identity = 35/72 (48.61%), Postives = 46/72 (63.89%), Query Frame = 1 Query: 220 LNEFSGDSEESTMFPAAESGRRKVETPPSAEIEEFFAMAEKYE--QKRFAEKYNFDIVRDMPLEGRYQWVRL 429 L E + + E S+ + G RK TP +AEIE+ F+ E + +K+F EKYNFDIV D PLEGRY+W RL Sbjct: 127 LGETTTEMESSSATKRKQPGVRK--TPTAAEIEDLFSELESQDDKKKQFIEKYNFDIVNDEPLEGRYKWDRL 196
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP5_ARATH (Cyclin-dependent kinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=KRP5 PE=1 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.596e-11 Identity = 25/41 (60.98%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 307 AEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRL 429 +EIE+FFA AE+ +Q+ F +KYNFDIV D PL GRY+WV++ Sbjct: 147 SEIEDFFASAEQQQQRFFIQKYNFDIVSDNPLPGRYEWVKV 187
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP4_ARATH (Cyclin-dependent kinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=KRP4 PE=1 SV=2) HSP 1 Score: 57.7658 bits (138), Expect = 1.968e-9 Identity = 26/54 (48.15%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 268 AESGRRKVETPPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRL 429 + S RR+ TP E++EFF+ AE+ +QK+F EKYNFD V + PL GR++W ++ Sbjct: 237 SRSHRRRPTTP---EMDEFFSGAEEEQQKQFIEKYNFDPVNEQPLPGRFEWTKV 287
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP4_ORYSJ (Cyclin-dependent kinase inhibitor 4 OS=Oryza sativa subsp. japonica OX=39947 GN=KRP4 PE=2 SV=2) HSP 1 Score: 56.225 bits (134), Expect = 2.741e-9 Identity = 24/45 (53.33%), Postives = 33/45 (73.33%), Query Frame = 1 Query: 295 TPPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRL 429 P SAE+E FFA E+ +++ F +KYNFD V D PL GR++WV+L Sbjct: 149 IPASAELEAFFAAEEQRQRQAFIDKYNFDPVNDCPLPGRFEWVKL 193
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP5_ORYSJ (Cyclin-dependent kinase inhibitor 5 OS=Oryza sativa subsp. japonica OX=39947 GN=KRP5 PE=2 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 1.285e-7 Identity = 30/58 (51.72%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 274 SGRRKVET------PPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRL 429 S RR++ET P S E+EEFFA AE+ + + F E+YNF V D PL GRY+W RL Sbjct: 162 SSRRRMETSVCRYVPSSLEMEEFFAAAEQQQHQAFRERYNFCPVNDCPLPGRYEWTRL 219
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP1_ARATH (Cyclin-dependent kinase inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=KRP1 PE=1 SV=2) HSP 1 Score: 51.2174 bits (121), Expect = 2.007e-7 Identity = 25/47 (53.19%), Postives = 35/47 (74.47%), Query Frame = 1 Query: 292 ETPPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQWVRLH 432 E P +EIE+FF AEK +++F +KYNFD ++ PLEGRY+WV+L Sbjct: 145 EMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE 191
BLAST of rna-KK1_020580 vs. DB:Swiss
Match: KRP3_ORYSJ (Cyclin-dependent kinase inhibitor 3 OS=Oryza sativa subsp. japonica OX=39947 GN=KRP3 PE=2 SV=2) HSP 1 Score: 51.2174 bits (121), Expect = 3.223e-7 Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 1 Query: 277 GRRKVETPPSAEIEEFFAMAEKYEQKRFAEKYNFDIVRDMPLEGRYQW 420 GRR +PP AEIE FFA AE E++RFAEKYN+DI D PL+GRY+W Sbjct: 162 GRRPPLSPPEAEIEAFFAAAELAERRRFAEKYNYDIALDRPLQGRYEW 209 The following BLAST results are available for this feature:
BLAST of rna-KK1_020580 vs. DB:Swiss
Analysis Date: 2019-10-17 (BLAST: C. cajan Asha genome v1.0 vs. Swissprot) Total hits: 10
InterPro
Analysis Name: Cajanus cajan Asha genome v1.0
Date Performed: 2019-09-17
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-KK1_020580_Cc_Asha_v1.0 ID=rna-KK1_020580_Cc_Asha_v1.0; Name=rna-KK1_020580; organism=Cajanus cajan; type=mRNA; length=435bpback to top protein sequence of rna-KK1_020580_Cc_Asha_v1.0 >rna-KK1_020580_Cc_Asha_v1.0 ID=rna-KK1_020580_Cc_Asha_v1.0; Name=rna-KK1_020580_Cc_Asha_v1.0; organism=Cajanus cajan; type=polypeptide; length=144bpback to top mRNA from alignment at Chr_1-CM003603.1:8445166..8446000+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>rna-KK1_020580_Cc_Asha_v1.0 ID=rna-KK1_020580_Cc_Asha_v1.0; Name=rna-KK1_020580; organism=Cajanus cajan; type=mRNA; length=835bp; location=Sequence derived from: Chr_1-CM003603.1:8445166..8446000+ (Cajanus cajanback to top Coding sequence (CDS) from alignment at Chr_1-CM003603.1:8445166..8446000+ >rna-KK1_020580_Cc_Asha_v1.0 ID=rna-KK1_020580_Cc_Asha_v1.0; Name=rna-KK1_020580; organism=Cajanus cajan; type=CDS; length=870bp; location=Sequence derived from: Chr_1-CM003603.1:8445166..8446000+ (Cajanus cajanback to top Annotated Terms
The
following terms have been associated with
this mRNA:
|