rna-TanjilR_13894
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of rna-TanjilR_13894 vs. DB:Swiss
Match: TOB1A_XENLA (DNA topoisomerase 2-binding protein 1-A OS=Xenopus laevis OX=8355 GN=topbp1-A PE=1 SV=2) HSP 1 Score: 61.2326 bits (147), Expect = 2.427e-7 Identity = 43/121 (35.54%), Postives = 63/121 (52.07%), Query Frame = 1 Query: 8674 IYTDTFIMMCLFKAGSLLDVEGHILYSPLPCRVPLPGFESFRFCV---SQYDEKDRILLRNLCFVLGAK----FVEKLTKK-----VTHLLCRFTNGPKYEAACKWGVRSVTSEWILECVK 9000 + T+ ++ MC+ + LLD + L++P+P L G R CV SQ+ +R L L +LGAK FV K K THL+ + G KYEAA KW + +VT W+L+C + Sbjct: 598 VVTNAWLGMCIEQE-KLLDPHSNALFTPVPF---LEGSTPLRECVLSVSQFMGAERDSLVYLAGLLGAKVQEFFVRKANPKKGMFASTHLVLKDAEGSKYEAAKKWNLPAVTMNWLLQCAR 714 The following BLAST results are available for this feature:
BLAST of rna-TanjilR_13894 vs. DB:Swiss
Analysis Date: 2020-01-28 (BLAST: L. angustifolius cv. Tanjil genome v1.0 vs. Swissprot) Total hits: 1 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan: L. angustifolius cv. Tanjil genome v1.0
Date Performed: 2020-01-28 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-TanjilR_13894_La_Tanjil_v1.0 ID=rna-TanjilR_13894_La_Tanjil_v1.0; Name=rna-TanjilR_13894; organism=Lupinus angustifolius; type=mRNA; length=10587bpback to top protein sequence of rna-TanjilR_13894_La_Tanjil_v1.0 >rna-TanjilR_13894_La_Tanjil_v1.0 ID=rna-TanjilR_13894_La_Tanjil_v1.0; Name=rna-TanjilR_13894_La_Tanjil_v1.0; organism=Lupinus angustifolius; type=polypeptide; length=946bpback to top mRNA from alignment at Chr_LG09-CM007369.1:17880840..17891426+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>rna-TanjilR_13894_La_Tanjil_v1.0 ID=rna-TanjilR_13894_La_Tanjil_v1.0; Name=rna-TanjilR_13894; organism=Lupinus angustifolius; type=mRNA; length=10587bp; location=Sequence derived from: Chr_LG09-CM007369.1:17880840..17891426+ (Lupinus angustifoliusback to top Coding sequence (CDS) from alignment at Chr_LG09-CM007369.1:17880840..17891426+ >rna-TanjilR_13894_La_Tanjil_v1.0 ID=rna-TanjilR_13894_La_Tanjil_v1.0; Name=rna-TanjilR_13894; organism=Lupinus angustifolius; type=CDS; length=2841bp; location=Sequence derived from: Chr_LG09-CM007369.1:17880840..17891426+ (Lupinus angustifoliusback to top |