Ca_04907, Ca_04907_v1.0_kabuli (mRNA) Cicer arietinum
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of Ca_04907 vs. TrEMBL
Match: G7J4N5_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MTR_3g113080 PE=4 SV=1) HSP 1 Score: 104.76 bits (260), Expect = 1.406e-20 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 1 Query: 436 ISHYIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 + YIVGQFAQCM KT CKGMRLDCPLHCGGPCYYDCHHMCKAHCR Sbjct: 118 VEDYIVGQFAQCMTKTRCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 163 HSP 2 Score: 85.1149 bits (209), Expect = 1.153e-14 Identity = 45/67 (67.16%), Postives = 53/67 (79.10%), Query Frame = 1 Query: 1 METFRNYGVVYLVLLVIAIGRLKGEDELANGNAPNKGNATFIT---PSQGINEEGKENNSNSYDKIV 192 METFRN+GVV L+LL+IAI LKG++E N NAPNKGNATF+T SQGINEEGKE + N Y+K V Sbjct: 1 METFRNHGVVCLLLLLIAIVGLKGDEEHTNVNAPNKGNATFVTLSNSSQGINEEGKEKHDNIYNKDV 67
BLAST of Ca_04907 vs. TrEMBL
Match: K7KSQ2_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 96.6709 bits (239), Expect = 3.830e-18 Identity = 36/43 (83.72%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y VG++A+CMAKT C+GMRL+CPLHCGGPCYYDCHHMCKAHCR Sbjct: 177 YRVGEYAECMAKTRCRGMRLECPLHCGGPCYYDCHHMCKAHCR 219
BLAST of Ca_04907 vs. TrEMBL
Match: K7M8M4_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 95.5153 bits (236), Expect = 8.532e-18 Identity = 35/43 (81.40%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y +G+FAQCMA+T C+G+RLDCPLHCGGPC+YDCHHMCKAHCR Sbjct: 145 YRMGEFAQCMARTRCRGLRLDCPLHCGGPCFYDCHHMCKAHCR 187
BLAST of Ca_04907 vs. TrEMBL
Match: K7MNZ8_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 94.3597 bits (233), Expect = 1.901e-17 Identity = 34/43 (79.07%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y +G++AQCMA+T C+G+RLDCPLHCGGPC+YDCHHMCKAHCR Sbjct: 145 YRMGEYAQCMARTRCRGLRLDCPLHCGGPCFYDCHHMCKAHCR 187
BLAST of Ca_04907 vs. TrEMBL
Match: G7I5W6_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MTR_1g023270 PE=4 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.483e-17 Identity = 35/43 (81.40%), Postives = 40/43 (93.02%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y +G+FAQCM +T CKGMRLDCPLHCGGPC+YDC+HMCKAHCR Sbjct: 151 YRLGEFAQCMTRTRCKGMRLDCPLHCGGPCFYDCYHMCKAHCR 193
BLAST of Ca_04907 vs. TrEMBL
Match: F6GZQ6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0001g13540 PE=4 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 1.609e-16 Identity = 34/43 (79.07%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y++G+FAQCM + CKGMRLDCPLHCGGPC YDC HMCKAHCR Sbjct: 155 YVMGEFAQCMVRGRCKGMRLDCPLHCGGPCLYDCQHMCKAHCR 197
BLAST of Ca_04907 vs. TrEMBL
Match: B9R833_RICCO (Nutrient reservoir, putative OS=Ricinus communis GN=RCOM_1596370 PE=4 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 3.963e-15 Identity = 32/43 (74.42%), Postives = 37/43 (86.05%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y +G++AQCM + CK MRLDCPLHCGGPC+YDC HMCKAHCR Sbjct: 137 YKIGEYAQCMGEGRCKWMRLDCPLHCGGPCFYDCQHMCKAHCR 179
BLAST of Ca_04907 vs. TrEMBL
Match: M0TTJ8_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.319e-10 Identity = 26/45 (57.78%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 439 SHYIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 S Y VG++A+C + C GM+L CP+HC GPC+YDCH C+AHCR Sbjct: 206 SLYRVGEYARCSGRGRCGGMKLLCPMHCDGPCFYDCHSNCRAHCR 250
BLAST of Ca_04907 vs. TrEMBL
Match: C5Z1R7_SORBI (Putative uncharacterized protein Sb10g012740 OS=Sorghum bicolor GN=Sb10g012740 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.723e-10 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 1 Query: 439 SHYIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 S Y VG++A+C A C GMRL CP+HC GPC+YDC CKAHCR Sbjct: 140 SLYRVGEYARCTAPGRCSGMRLLCPMHCDGPCFYDCDANCKAHCR 184
BLAST of Ca_04907 vs. TrEMBL
Match: K7VCY2_MAIZE (Uncharacterized protein OS=Zea mays GN=ZEAMMB73_627578 PE=4 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.251e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 1 Query: 445 YIVGQFAQCMAKTPCKGMRLDCPLHCGGPCYYDCHHMCKAHCR 573 Y VG++A+C A C GMRL CP+HC GPC+YDC CKAHCR Sbjct: 163 YRVGEYARCTAPGRCSGMRLLCPMHCDGPCFYDCDANCKAHCR 205 The following BLAST results are available for this feature:
BLAST of Ca_04907 vs. TrEMBL
Analysis Date: 2013-10-24 (Homology Analysis: Kabuli C.arietinum mRNA vs TrEMBL) Total hits: 19 Position : 0 Zoom : x 1
Pagesback to top
BLAST of Ca_04907 vs. DB:Swiss
Analysis Date: 2019-05-21 (BLAST: C. arietinum CDC Frontier (kabuli), Swissprot) Total hits: 0 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan analysis for kabuli C. arietinum unigenes
Date Performed: 2013-10-24 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >Ca_04907_v1.0_kabuli ID=Ca_04907_v1.0_kabuli; Name=Ca_04907; organism=Cicer arietinum; type=mRNA; length=579bpback to top protein sequence of Ca_04907_v1.0_kabuli >Ca_04907_v1.0_kabuli ID=Ca_04907_v1.0_kabuli; Name=Ca_04907_v1.0_kabuli; organism=Cicer arietinum; type=polypeptide; length=192bpback to top mRNA from alignment at Ca5:32031226..32031804+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ca_04907_v1.0_kabuli ID=Ca_04907_v1.0_kabuli; Name=Ca_04907; organism=Cicer arietinum; type=mRNA; length=579bp; location=Sequence derived from: Ca5:32031226..32031804+ (Cicer arietinumback to top Coding sequence (CDS) from alignment at Ca5:32031226..32031804+ >Ca_04907_v1.0_kabuli ID=Ca_04907_v1.0_kabuli; Name=Ca_04907; organism=Cicer arietinum; type=CDS; length=579bp; location=Sequence derived from: Ca5:32031226..32031804+ (Cicer arietinumback to top |